PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA025449-PA
Common NameOsI_25500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 329aa    MW: 35844.5 Da    PI: 9.3149
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA025449-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-1794140148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  BGIOSGA025449-PA  94 KGGWTREEDEVLRQMVQHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                       688*****************************.************996 PP

2Myb_DNA-binding55.91e-17146188145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +g WT+eEd +l++a++ +G++ W++Iar ++ gR+++ +k+rw+
  BGIOSGA025449-PA 146 KGIWTEEEDRKLIRAHQTYGNR-WSAIARSLP-GRSENTVKNRWN 188
                       678*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.17889144IPR017930Myb domain
SuperFamilySSF466893.88E-3191187IPR009057Homeodomain-like
SMARTSM007172.7E-1693142IPR001005SANT/Myb domain
PfamPF002496.5E-1694140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2496144IPR009057Homeodomain-like
CDDcd001673.53E-1697140No hitNo description
Gene3DG3DSA:1.10.10.603.3E-23145192IPR009057Homeodomain-like
SMARTSM007171.6E-17145193IPR001005SANT/Myb domain
PROSITE profilePS5129418.274145195IPR017930Myb domain
PfamPF002492.8E-16146188IPR001005SANT/Myb domain
CDDcd001674.36E-15149191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MATDRMPDSH FMASSNGGAC YQNTHGTPIT MGVPNLGCLV ASIGIAPSSS LMPERGLATA  60
NYNLVANFPE DAAVVPQQQQ LQAASSNSNS GLIKGGWTRE EDEVLRQMVQ HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HPDIKKGIWT EEEDRKLIRA HQTYGNRWSA IARSLPGRSE  180
NTVKNRWNAT KRSLNSKRRL RKKNSEQAVP RQPSLLEEYI RSCQHPLPNE TAPPASFDIG  240
GYGTGGTIGA SPTPPTVHAL GGSTPLGLVM FLDLLNQATP HPPQPDLNLL NITPVVPHLN  300
TSGYCLQLDA RGNCSMASCR CNPTGSAPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-40921922102MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-395819225156MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-395819225156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.11e-169PREDICTED: transcription factor RAX1-like
TrEMBLA2YJV00.0A2YJV0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA025449-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-44myb domain protein 98